Anti-LILRB5
Catalog Number:
ATA-HPA012069
- Images (7)
| Article Name: | Anti-LILRB5 |
| Biozol Catalog Number: | ATA-HPA012069 |
| Supplier Catalog Number: | HPA012069 |
| Alternative Catalog Number: | ATA-HPA012069-100,ATA-HPA012069-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD85c, LIR-8, LIR8 |
| leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5 |
| Anti-LILRB5 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10990 |
| UniProt: | O75023 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LILRB5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skin shows no positivity in keratinocytes as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) |
|
|
HPA012069-100ul |
|
|
HPA012069-100ul |
|
|
HPA012069-100ul |
Product Guarantee and Expert Support
