Anti-TCEAL9

Catalog Number: ATA-HPA012106
Article Name: Anti-TCEAL9
Biozol Catalog Number: ATA-HPA012106
Supplier Catalog Number: HPA012106
Alternative Catalog Number: ATA-HPA012106-100,ATA-HPA012106-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp313K1940, WBP5, WEX6
Clonality: Polyclonal
Concentration: 0,05
NCBI: 51186
UniProt: Q9UHQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN
Target: TCEAL9
HPA012106-100ul