Anti-SP1

Catalog Number: ATA-HPA012292
Article Name: Anti-SP1
Biozol Catalog Number: ATA-HPA012292
Supplier Catalog Number: HPA012292
Alternative Catalog Number: ATA-HPA012292-100,ATA-HPA012292-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SP1
Sp1 transcription factor
Anti-SP1
Clonality: Polyclonal
Isotype: IgG
NCBI: 6667
UniProt: P08047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human small intestine shows nuclear positivity in glandular cells.
HPA012292-100ul
HPA012292-100ul
HPA012292-100ul