Anti-FAM172A

Catalog Number: ATA-HPA012299
Article Name: Anti-FAM172A
Biozol Catalog Number: ATA-HPA012299
Supplier Catalog Number: HPA012299
Alternative Catalog Number: ATA-HPA012299-100,ATA-HPA012299-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C5orf21, DKFZP564D172
family with sequence similarity 172, member A
Anti-FAM172A
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 83989
UniProt: Q8WUF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVSIPVDATESEPKS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FAM172A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells and cells in molecular layer.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-FAM172A antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA012299-100ul