Anti-LRCH3 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA012380
| Article Name: |
Anti-LRCH3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA012380 |
| Supplier Catalog Number: |
HPA012380 |
| Alternative Catalog Number: |
ATA-HPA012380-100,ATA-HPA012380-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, IHC, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
MGC4126 |
| leucine-rich repeats and calponin homology (CH) domain containing 3 |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
84859 |
| UniProt: |
Q96II8 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
HASPLPPSAAPTTDSTDSITGQNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSP |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
LRCH3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells. |
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
HPA012380 |
|
|
|
|
|
HPA012380 |
|
HPA012380 |