Anti-HECA

Catalog Number: ATA-HPA012581
Article Name: Anti-HECA
Biozol Catalog Number: ATA-HPA012581
Supplier Catalog Number: HPA012581
Alternative Catalog Number: ATA-HPA012581-100,ATA-HPA012581-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dJ225E12.1, HDC, HDCL, hHDC
Clonality: Polyclonal
Isotype: IgG
NCBI: 51696
UniProt: Q9UBI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVP
Target: HECA
Antibody Type: Monoclonal Antibody
HPA012581-100ul