Anti-FKBP9

Catalog Number: ATA-HPA012595
Article Name: Anti-FKBP9
Biozol Catalog Number: ATA-HPA012595
Supplier Catalog Number: HPA012595
Alternative Catalog Number: ATA-HPA012595-100,ATA-HPA012595-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FKBP60, FKBP63
FK506 binding protein 9, 63 kDa
Anti-FKBP9
Clonality: Polyclonal
Isotype: IgG
NCBI: 11328
UniProt: O95302
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FKBP9
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA012595-100ul
HPA012595-100ul
HPA012595-100ul