Anti-IGSF1
Catalog Number:
ATA-HPA012732
- Images (8)
| Article Name: | Anti-IGSF1 |
| Biozol Catalog Number: | ATA-HPA012732 |
| Supplier Catalog Number: | HPA012732 |
| Alternative Catalog Number: | ATA-HPA012732-100,ATA-HPA012732-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IGCD1, IGDC1, INHBP, KIAA0364, MGC75490, PGSF2 |
| immunoglobulin superfamily member 1 |
| Anti-IGSF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 3547 |
| UniProt: | Q8N6C5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKVLELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICRTHIQM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IGSF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human liver, lymph node, pituitary gland and testis using Anti-IGSF1 antibody HPA012732 (A) shows similar protein distribution across tissues to independent antibody HPA035582 (B). |
|
|
Immunohistochemical staining of human testis using Anti-IGSF1 antibody HPA012732. |
|
|
Immunohistochemical staining of human pituitary gland using Anti-IGSF1 antibody HPA012732. |
|
|
Immunohistochemical staining of human lymph node using Anti-IGSF1 antibody HPA012732. |
|
|
Immunohistochemical staining of human liver using Anti-IGSF1 antibody HPA012732. |
|
|
HPA012732-100ul |
|
|
HPA012732-100ul |
|
|
HPA012732-100ul |
Product Guarantee and Expert Support
