Anti-MAP2
Catalog Number:
ATA-HPA012828
- Images (10)
| Article Name: | Anti-MAP2 |
| Biozol Catalog Number: | ATA-HPA012828 |
| Supplier Catalog Number: | HPA012828 |
| Alternative Catalog Number: | ATA-HPA012828-100,ATA-HPA012828-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MAP2A, MAP2B, MAP2C |
| microtubule-associated protein 2 |
| Anti-MAP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4133 |
| UniProt: | P11137 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MAP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & cytosol. |
|
|
Immunofluorescence staining of mouse cerebral cortex shows immunoreactivity in neurons and dendrites. |
|
|
Immunofluorescence staining of mouse globus pallidus shows immunoreactivity in dense network of dendrites. |
|
|
Immunofluorescence staining of mouse lateral septum shows immunoreactivity in neurons and processes. |
|
|
Immunofluorescence staining of mouse facial nucleus shows strong positivity in neuronal cell bodies and processes. |
|
|
Immunofluorescence staining of mouse hippocampus shows selective immunoreactivity in the CA1 area. |
|
|
HPA012828-100ul |
|
|
|
|
|
HPA012828-100ul |
|
|
HPA012828-100ul |
Product Guarantee and Expert Support
