Anti-NLRP3
Catalog Number:
ATA-HPA012878
- Images (7)
| Article Name: | Anti-NLRP3 |
| Biozol Catalog Number: | ATA-HPA012878 |
| Supplier Catalog Number: | HPA012878 |
| Alternative Catalog Number: | ATA-HPA012878-100,ATA-HPA012878-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AGTAVPRL, AII, AVP, C1orf7, CIAS1, CLR1.1, FCAS, FCU, MWS, NALP3, PYPAF1 |
| NLR family, pyrin domain containing 3 |
| Anti-NLRP3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 114548 |
| UniProt: | Q96P20 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NLRP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human spleen shows cytoplasmic positivity in lymphoid cells. |
|
|
HPA012878-100ul |
|
|
HPA012878-100ul |
|
|
HPA012878-100ul |
Product Guarantee and Expert Support
