Anti-PTRH2

Catalog Number: ATA-HPA012897
Article Name: Anti-PTRH2
Biozol Catalog Number: ATA-HPA012897
Supplier Catalog Number: HPA012897
Alternative Catalog Number: ATA-HPA012897-100,ATA-HPA012897-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BIT1, CFAP37, CGI-147, PTH2
peptidyl-tRNA hydrolase 2
Anti-PTRH2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 51651
UniProt: Q9Y3E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PTRH2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity, with a granular pattern, in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA012897-100ul
HPA012897-100ul
HPA012897-100ul