Anti-DNAJC5
Catalog Number:
ATA-HPA013154
| Article Name: |
Anti-DNAJC5 |
| Biozol Catalog Number: |
ATA-HPA013154 |
| Supplier Catalog Number: |
HPA013154 |
| Alternative Catalog Number: |
ATA-HPA013154-100,ATA-HPA013154-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Molekularbiologie |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CLN4, DNAJC5A, FLJ00118, FLJ13070 |
| DnaJ (Hsp40) homolog, subfamily C, member 5 |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
80331 |
| UniProt: |
Q9H3Z4 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDAT |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
DNAJC5 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:50 - 1:200 |
![]()
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli. |
![]()
|
HPA013154-100ul |
