Anti-CELF4

Catalog Number: ATA-HPA013322
Article Name: Anti-CELF4
Biozol Catalog Number: ATA-HPA013322
Supplier Catalog Number: HPA013322
Alternative Catalog Number: ATA-HPA013322-100,ATA-HPA013322-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BRUNOL4
Clonality: Polyclonal
Isotype: IgG
NCBI: 56853
UniProt: Q9BZC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQS
Target: CELF4
Antibody Type: Monoclonal Antibody
HPA013322-100ul