Anti-KANK4
Catalog Number:
ATA-HPA014030
- Images (8)
| Article Name: | Anti-KANK4 |
| Biozol Catalog Number: | ATA-HPA014030 |
| Supplier Catalog Number: | HPA014030 |
| Alternative Catalog Number: | ATA-HPA014030-100,ATA-HPA014030-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ANKRD38, KIAA0172 |
| KN motif and ankyrin repeat domains 4 |
| Anti-KANK4 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 163782 |
| UniProt: | Q5T7N3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTDVMVNTDPVHGLLTRESCDKGIEVNLLGSMESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQGPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGTRGAGGFLWGS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KANK4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes as expected. |
|
|
HPA014030-100ul |
|
|
|
|
|
HPA014030-100ul |
|
|
HPA014030-100ul |
Product Guarantee and Expert Support
