Anti-MCTP2
Catalog Number:
ATA-HPA014135
| Article Name: |
Anti-MCTP2 |
| Biozol Catalog Number: |
ATA-HPA014135 |
| Supplier Catalog Number: |
HPA014135 |
| Alternative Catalog Number: |
ATA-HPA014135-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
FLJ11175, FLJ33303 |
| Rabbit Polyclonal MCTP2 Antibody against Human multiple C2 and transmembrane domain containing 2. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 |
| NCBI: |
55784 |
| UniProt: |
Q6DN12 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
RPVKGKVSSIQDSQESTDIDDEEDEDDKESEKKGLIERIYMVQDIVSTVQNVLEEIASFGERIKNT |
|
WB Image Caption 1 |