Anti-GHRL
Catalog Number:
ATA-HPA014246
- Images (8)
| Article Name: | Anti-GHRL |
| Biozol Catalog Number: | ATA-HPA014246 |
| Supplier Catalog Number: | HPA014246 |
| Alternative Catalog Number: | ATA-HPA014246-100,ATA-HPA014246-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ghrelin, MTLRP, obestatin |
| ghrelin/obestatin prepropeptide |
| Anti-GHRL |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 51738 |
| UniProt: | Q9UBU3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GHRL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human stomach and liver tissues using Anti-GHRL antibody. Corresponding GHRL RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and GHRL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402547). |
|
|
HPA014246-100ul |
|
|
|
|
|
HPA014246-100ul |
|
|
HPA014246-100ul |
Product Guarantee and Expert Support
