Anti-UAP1

Catalog Number: ATA-HPA014659
Article Name: Anti-UAP1
Biozol Catalog Number: ATA-HPA014659
Supplier Catalog Number: HPA014659
Alternative Catalog Number: ATA-HPA014659-100,ATA-HPA014659-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AgX, AGX1, SPAG2
UDP-N-acetylglucosamine pyrophosphorylase 1
Anti-UAP1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 6675
UniProt: Q16222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: UAP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-UAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in human cell line U-251 MG.
HPA014659-100ul
HPA014659-100ul
HPA014659-100ul