Anti-CMTM4

Catalog Number: ATA-HPA014704
Article Name: Anti-CMTM4
Biozol Catalog Number: ATA-HPA014704
Supplier Catalog Number: HPA014704
Alternative Catalog Number: ATA-HPA014704-100,ATA-HPA014704-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CKLFSF4
CKLF-like MARVEL transmembrane domain containing 4
Anti-CMTM4
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 146223
UniProt: Q8IZR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CMTM4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry analysis in human thyroid gland and lymph node tissues using Anti-CMTM4 antibody. Corresponding CMTM4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human thyroid gland shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
HPA014704-100ul
HPA014704-100ul
HPA014704-100ul