Anti-RALGPS1

Catalog Number: ATA-HPA014749
Article Name: Anti-RALGPS1
Biozol Catalog Number: ATA-HPA014749
Supplier Catalog Number: HPA014749
Alternative Catalog Number: ATA-HPA014749-100,ATA-HPA014749-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0351, RALGEF2, RALGPS1A
Clonality: Polyclonal
Concentration: 0,1
NCBI: 9649
UniProt: Q5JS13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NMMCQLSVVESKSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLES
Target: RALGPS1
HPA014749-100ul