Anti-ITPR1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA014765
- Images (9)
| Article Name: | Anti-ITPR1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA014765 |
| Supplier Catalog Number: | HPA014765 |
| Alternative Catalog Number: | ATA-HPA014765-100,ATA-HPA014765-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ACV, Insp3r1, IP3R1, PPP1R94, SCA15, SCA16, SCA29 |
| inositol 1,4,5-trisphosphate receptor, type 1 |
| Anti-ITPR1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 3708 |
| UniProt: | Q14643 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ITPR1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
Immunohistochemical staining of human skin shows no positivity in epidermal cells as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line U-87 MG |
|
|
HPA014765 |
|
|
|
|
|
HPA014765 |
|
|
HPA014765 |
Product Guarantee and Expert Support
