Anti-DDX47

Catalog Number: ATA-HPA014855
Article Name: Anti-DDX47
Biozol Catalog Number: ATA-HPA014855
Supplier Catalog Number: HPA014855
Alternative Catalog Number: ATA-HPA014855-100,ATA-HPA014855-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp564O176, FLJ30012, HQ0256, RRP3
DEAD (Asp-Glu-Ala-Asp) box polypeptide 47
Anti-DDX47
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 51202
UniProt: Q9H0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DDX47
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemical staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA014855-100ul
HPA014855-100ul
HPA014855-100ul