Anti-SGMS2

Catalog Number: ATA-HPA015541
Article Name: Anti-SGMS2
Biozol Catalog Number: ATA-HPA015541
Supplier Catalog Number: HPA015541
Alternative Catalog Number: ATA-HPA015541-100,ATA-HPA015541-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC26963, SMS2
Clonality: Polyclonal
Concentration: 0,05
NCBI: 166929
UniProt: Q8NHU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR
Target: SGMS2
HPA015541-100ul