Anti-AFAP1
Catalog Number:
ATA-HPA015642
- Images (8)
| Article Name: | Anti-AFAP1 |
| Biozol Catalog Number: | ATA-HPA015642 |
| Supplier Catalog Number: | HPA015642 |
| Alternative Catalog Number: | ATA-HPA015642-100,ATA-HPA015642-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AFAP, AFAP-110 |
| actin filament associated protein 1 |
| Anti-AFAP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 60312 |
| UniProt: | Q8N556 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISANPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRVEADAKR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AFAP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm, actin filaments & focal adhesion sites. |
|
|
Immunohistochemistry analysis in human colon and liver tissues using Anti-AFAP1 antibody. Corresponding AFAP1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA015642-100ul |
|
|
|
|
|
HPA015642-100ul |
|
|
HPA015642-100ul |
Product Guarantee and Expert Support
