Anti-RTN3
Catalog Number:
ATA-HPA015649
- Images (8)
| Article Name: | Anti-RTN3 |
| Biozol Catalog Number: | ATA-HPA015649 |
| Supplier Catalog Number: | HPA015649 |
| Alternative Catalog Number: | ATA-HPA015649-100,ATA-HPA015649-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ASYIP, HAP, NSPL2, NSPLII, RTN3-A1 |
| reticulon 3 |
| Anti-RTN3 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 10313 |
| UniProt: | O95197 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VPQVKQQTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKPVPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDW |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RTN3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, liver and lymph node using Anti-RTN3 antibody HPA015649 (A) shows similar protein distribution across tissues to independent antibody HPA015650 (B). |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in lymphoid cells as expected. |
|
|
Immunohistochemical staining of human colon shows no positivity in glandular cells as expected. |
|
|
HPA015649-100ul |
|
|
HPA015649-100ul |
|
|
HPA015649-100ul |
Product Guarantee and Expert Support
