Anti-BNIP3L

Catalog Number: ATA-HPA015652
Article Name: Anti-BNIP3L
Biozol Catalog Number: ATA-HPA015652
Supplier Catalog Number: HPA015652
Alternative Catalog Number: ATA-HPA015652-100,ATA-HPA015652-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BNIP3a, Nix
BCL2/adenovirus E1B 19kDa interacting protein 3-like
Anti-BNIP3L
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 665
UniProt: O60238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BNIP3L
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria.
Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-BNIP3L antibody. Corresponding BNIP3L RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA015652-100ul
HPA015652-100ul
HPA015652-100ul