Anti-CD226
Catalog Number:
ATA-HPA015715
- Images (7)
| Article Name: | Anti-CD226 |
| Biozol Catalog Number: | ATA-HPA015715 |
| Supplier Catalog Number: | HPA015715 |
| Alternative Catalog Number: | ATA-HPA015715-100,ATA-HPA015715-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DNAM-1, DNAM1, PTA1, TLiSA1 |
| CD226 molecule |
| Anti-CD226 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10666 |
| UniProt: | Q15762 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD226 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human spleen shows moderate positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human tonsil shows strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA015715-100ul |
|
|
HPA015715-100ul |
|
|
HPA015715-100ul |
Product Guarantee and Expert Support
