Anti-ERGIC3
Catalog Number:
ATA-HPA015968
- Images (7)
| Article Name: | Anti-ERGIC3 |
| Biozol Catalog Number: | ATA-HPA015968 |
| Supplier Catalog Number: | HPA015968 |
| Alternative Catalog Number: | ATA-HPA015968-100,ATA-HPA015968-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84 |
| ERGIC and golgi 3 |
| Anti-ERGIC3 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 51614 |
| UniProt: | Q9Y282 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ERGIC3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA015968-100ul |
|
|
|
|
|
HPA015968-100ul |
|
|
HPA015968-100ul |
Product Guarantee and Expert Support
