Anti-TNXB

Catalog Number: ATA-HPA016017
Article Name: Anti-TNXB
Biozol Catalog Number: ATA-HPA016017
Supplier Catalog Number: HPA016017
Alternative Catalog Number: ATA-HPA016017-100,ATA-HPA016017-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HXBL, TN-X, TNX, TNXB1, TNXB2, TNXBS, XB, XBS
Clonality: Polyclonal
Concentration: 0,05
NCBI: 7148
UniProt: P22105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDA
Target: TNXB
HPA016017-100ul