Anti-WDR53

Catalog Number: ATA-HPA016420
Article Name: Anti-WDR53
Biozol Catalog Number: ATA-HPA016420
Supplier Catalog Number: HPA016420
Alternative Catalog Number: ATA-HPA016420-100,ATA-HPA016420-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC12928, MGC64882
WD repeat domain 53
Anti-WDR53
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 348793
UniProt: Q7Z5U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PVLCLNASKEGLLASGAEGGDLTAWGEDGTPLGHTRFQGADDVTSVLFSPSCPTKLYASHGETISVLDVRSLKDSLDHFHVNEEEINCLSLNQTENLLASADDSGAIKILDLENKKVIRSLKRHSNICSSV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: WDR53
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells.
Western blot analysis using Anti-WDR53 antibody HPA016420 (A) shows similar pattern to independent antibody HPA019332 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA016420-100ul
HPA016420-100ul
HPA016420-100ul