Anti-SLC39A14 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA016508
Article Name: Anti-SLC39A14 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA016508
Supplier Catalog Number: HPA016508
Alternative Catalog Number: ATA-HPA016508-100, ATA-HPA016508-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0062, NET34, ZIP14
Clonality: Polyclonal
NCBI: 23516
UniProt: Q15043
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSD
Target: SLC39A14