Anti-KDM3B

Catalog Number: ATA-HPA016610
Article Name: Anti-KDM3B
Biozol Catalog Number: ATA-HPA016610
Supplier Catalog Number: HPA016610
Alternative Catalog Number: ATA-HPA016610-100,ATA-HPA016610-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C5orf7, JMJD1B, KIAA1082, NET22
lysine (K)-specific demethylase 3B
Anti-KDM3B
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 51780
UniProt: Q7LBC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GEVDSNGSDGGEASRGPWKGGNASGEPGLDQRAKQPPSTFVPQINRNIRFATYTKENGRTLVVQDEPVGGDTPASFTPYSTATGQTPLAPEVGGAENKEAGKTLEQVGQGIVASAAVVTTASSTPNTVRISDTGLAAGTVPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: KDM3B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human fallopian tube shows nuclear positivity in glandular cells.
Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-KDM3B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA016610-100ul
HPA016610-100ul
HPA016610-100ul