Anti-ANO10

Catalog Number: ATA-HPA016624
Article Name: Anti-ANO10
Biozol Catalog Number: ATA-HPA016624
Supplier Catalog Number: HPA016624
Alternative Catalog Number: ATA-HPA016624-100,ATA-HPA016624-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10375, MGC47890, SCAR10, TMEM16K
Clonality: Polyclonal
Isotype: IgG
NCBI: 55129
UniProt: Q9NW15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL
Target: ANO10
Antibody Type: Monoclonal Antibody
HPA016624-100ul