Anti-USP30 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-USP30 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA016952
• Supplier Catalog Number: HPA016952
• Alternative Catalog Number: ATA-HPA016952-100,ATA-HPA016952-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ40511, MGC10702

Product Description

ubiquitin specific peptidase 30

Additional Information

Anti-USP30

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 84749
• UniProt: Q70CQ3
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: USP30
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in renal tubules cells.

Western blot analysis in control (vector only transfected HEK293T lysate) and USP30 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409983).

HPA016952

HPA016952

HPA016952