Anti-USP30

Catalog Number: ATA-HPA016952
Article Name: Anti-USP30
Biozol Catalog Number: ATA-HPA016952
Supplier Catalog Number: HPA016952
Alternative Catalog Number: ATA-HPA016952-100,ATA-HPA016952-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ40511, MGC10702
ubiquitin specific peptidase 30
Anti-USP30
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 84749
UniProt: Q70CQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: USP30
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in renal tubules cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and USP30 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409983).
HPA016952-100ul
HPA016952-100ul
HPA016952-100ul