Anti-DNAJB11

Catalog Number: ATA-HPA017051
Article Name: Anti-DNAJB11
Biozol Catalog Number: ATA-HPA017051
Supplier Catalog Number: HPA017051
Alternative Catalog Number: ATA-HPA017051-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: EDJ, ERdj3, HEDJ
DnaJ (Hsp40) homolog, subfamily B, member 11
Anti-DNAJB11
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 51726
UniProt: Q9UBS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNAJB11
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and DNAJB11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402537).
HPA017051-100ul
HPA017051-100ul
HPA017051-100ul