Anti-DNAJB11 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-DNAJB11 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017051
• Supplier Catalog Number: HPA017051
• Alternative Catalog Number: ATA-HPA017051-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: EDJ, ERdj3, HEDJ

Product Description

DnaJ (Hsp40) homolog, subfamily B, member 11

Additional Information

Anti-DNAJB11

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 51726
• UniProt: Q9UBS4
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DNAJB11
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Western blot analysis in control (vector only transfected HEK293T lysate) and DNAJB11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402537).

HPA017051

HPA017051

HPA017051