Anti-CEMIP2

Catalog Number: ATA-HPA017080
Article Name: Anti-CEMIP2
Biozol Catalog Number: ATA-HPA017080
Supplier Catalog Number: HPA017080
Alternative Catalog Number: ATA-HPA017080-100,ATA-HPA017080-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TMEM2
Clonality: Polyclonal
Concentration: 0,05
NCBI: 23670
UniProt: Q9UHN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GDPSVISVNGTDFTFRSAGVLLLVVDPCSVPFRLTEKTVFPLADVSRIEEYLKTGIPPRSIVLLSTRGEIKQLNISHLLVPLGLAKPAHLYDKGSTIFLGFSGNFKPSWTKLFTSPAGQGLGVLEQFIPLQLDEYGCPR
Target: CEMIP2
HPA017080-100ul