Anti-TEX264 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA017739
- Images (9)
| Article Name: | Anti-TEX264 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA017739 |
| Supplier Catalog Number: | HPA017739 |
| Alternative Catalog Number: | ATA-HPA017739-100,ATA-HPA017739-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ13935, ZSIG11 |
| testis expressed 264 |
| Anti-TEX264 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 51368 |
| UniProt: | Q9Y6I9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TEX264 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & cytosol. |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-TEX264 antibody. Corresponding TEX264 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA017739 |
|
|
|
|
|
HPA017739 |
|
|
HPA017739 |
Product Guarantee and Expert Support
