Anti-SLFN5
Catalog Number:
ATA-HPA017760
- Images (8)
| Article Name: | Anti-SLFN5 |
| Biozol Catalog Number: | ATA-HPA017760 |
| Supplier Catalog Number: | HPA017760 |
| Alternative Catalog Number: | ATA-HPA017760-100,ATA-HPA017760-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC19764 |
| schlafen family member 5 |
| Anti-SLFN5 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 162394 |
| UniProt: | Q08AF3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ERHGVGLDVPPIFRSHLDKMQKENHFLIFVKSWNTEAGVPLATLCSNLYHRERTSTDVMDSQEALAFLKCRTQTPTNINVSNSLGPQAAQGSVQYEGNINVSAAALFDRKRLQYLEKLNLPESTHVEFVMFSTDVSHCVKD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLFN5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human bone marrow shows strong nuclear positivity in subsets of hematopoietic cells. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-SLFN5 antibody. Corresponding SLFN5 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
HPA017760-100ul |
|
|
|
|
|
|
|
|
HPA017760-100ul |
|
|
HPA017760-100ul |
Product Guarantee and Expert Support
