Anti-TNRC6A
Catalog Number:
ATA-HPA017869
- Images (7)
| Article Name: | Anti-TNRC6A |
| Biozol Catalog Number: | ATA-HPA017869 |
| Supplier Catalog Number: | HPA017869 |
| Alternative Catalog Number: | ATA-HPA017869-100,ATA-HPA017869-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAGH26, GW182, KIAA1460, TNRC6 |
| trinucleotide repeat containing 6A |
| Anti-TNRC6A |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 27327 |
| UniProt: | Q8NDV7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSVQQQMMQQSRQLDPNLLVKQQTPPSQQQPLHQPAMKSFLDNVMPHTTPELQKGPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TNRC6A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human endometrium shows strong nuclear and moderate cytoplasmic immunoreactivity in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows strong nuclear combined with weaker granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows strong nuclear and moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak nuclear and cytoplasmic positivity in striated muscle fibers. |
|
|
HPA017869-100ul |
|
|
HPA017869-100ul |
|
|
HPA017869-100ul |
Product Guarantee and Expert Support
