Anti-KTN1
Catalog Number:
ATA-HPA017876
- Images (8)
| Article Name: | Anti-KTN1 |
| Biozol Catalog Number: | ATA-HPA017876 |
| Supplier Catalog Number: | HPA017876 |
| Alternative Catalog Number: | ATA-HPA017876-100,ATA-HPA017876-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CG1, KIAA0004 |
| kinectin 1 (kinesin receptor) |
| Anti-KTN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.6 mg/ml |
| Isotype: | IgG |
| NCBI: | 3895 |
| UniProt: | Q86UP2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ELKRLEAMLKERESDLSSKTQLLQDVQDENKLFKSQIEQLKQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNERQQQVEAVELEAKE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KTN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human cerebral cortex, lymph node, skin and testis using Anti-KTN1 antibody HPA017876 (A) shows similar protein distribution across tissues to independent antibody HPA003178 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-KTN1 antibody HPA017876. |
|
|
Immunohistochemical staining of human lymph node using Anti-KTN1 antibody HPA017876. |
|
|
Immunohistochemical staining of human skin using Anti-KTN1 antibody HPA017876. |
|
|
Immunohistochemical staining of human testis using Anti-KTN1 antibody HPA017876. |
|
|
HPA017876-100ul |
|
|
HPA017876-100ul |
|
|
HPA017876-100ul |
Product Guarantee and Expert Support
