Anti-RRP1B
Catalog Number:
ATA-HPA017893
- Images (8)
| Article Name: | Anti-RRP1B |
| Biozol Catalog Number: | ATA-HPA017893 |
| Supplier Catalog Number: | HPA017893 |
| Alternative Catalog Number: | ATA-HPA017893-100,ATA-HPA017893-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0179, Nnp1, PPP1R136, RRP1 |
| ribosomal RNA processing 1B |
| Anti-RRP1B |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 23076 |
| UniProt: | Q14684 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RRP1B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. |
|
|
Immunohistochemical staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RRP1B antibody. Remaining relative intensity is presented. |
|
|
HPA017893-100ul |
|
|
|
|
|
|
|
|
HPA017893-100ul |
|
|
HPA017893-100ul |
Product Guarantee and Expert Support
