Anti-NME6 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA017909
- Images (0)
| Article Name: | Anti-NME6 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA017909 |
| Supplier Catalog Number: | HPA017909 |
| Alternative Catalog Number: | ATA-HPA017909-100, ATA-HPA017909-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IPIA-ALPHA, NM23-H6 |
| Clonality: | Polyclonal |
| NCBI: | 10201 |
| UniProt: | O75414 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA |
| Target: | NME6 |
Product Guarantee and Expert Support
