Anti-MEA1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MEA1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017921
• Supplier Catalog Number: HPA017921
• Alternative Catalog Number: ATA-HPA017921-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: MEA

Product Description

male-enhanced antigen 1

Additional Information

Anti-MEA1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 4201
• UniProt: Q16626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ALNNHSSIPMDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQAS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferus ducts.

Western blot analysis in control (vector only transfected HEK293T lysate) and MEA1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415154).