Anti-SIGMAR1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA018002
Article Name: Anti-SIGMAR1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA018002
Supplier Catalog Number: HPA018002
Alternative Catalog Number: ATA-HPA018002-100,ATA-HPA018002-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: OPRS1, SR-BP1
sigma non-opioid intracellular receptor 1
Anti-SIGMAR1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 10280
UniProt: Q99720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SIGMAR1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human Fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic and membranous positivity in glandular cells.
Western blot analysis in human cell lines PC-3 and MCF-7 using Anti-SIGMAR1 antibody. Corresponding SIGMAR1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
HPA018002
HPA018002
HPA018002