Anti-MFSD13A
Catalog Number:
ATA-HPA018031
- Images (8)
| Article Name: | Anti-MFSD13A |
| Biozol Catalog Number: | ATA-HPA018031 |
| Supplier Catalog Number: | HPA018031 |
| Alternative Catalog Number: | ATA-HPA018031-100,ATA-HPA018031-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bA18I14.8, C10orf77, FLJ22529, TMEM180 |
| major facilitator superfamily domain containing 13A |
| Anti-MFSD13A |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 79847 |
| UniProt: | Q14CX5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QLLRRRVEAARKDPGCSGLVVDSGLCGEELLVGSEEADSITLGRYLRQLARHRN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MFSD13A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human small intestine shows distinct granular cytoplasmic positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA018031-100ul |
|
|
|
|
|
|
|
|
HPA018031-100ul |
|
|
HPA018031-100ul |
Product Guarantee and Expert Support
