Anti-SQLE
Catalog Number:
ATA-HPA018038
- Images (7)
| Article Name: | Anti-SQLE |
| Biozol Catalog Number: | ATA-HPA018038 |
| Supplier Catalog Number: | HPA018038 |
| Alternative Catalog Number: | ATA-HPA018038-100,ATA-HPA018038-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SQLE |
| squalene epoxidase |
| Anti-SQLE |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 6713 |
| UniProt: | Q14534 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLGDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAEPNAKFIEGVVLQLLEEDDVVMG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SQLE |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in myocytes. |
|
|
HPA018038-100ul |
|
|
HPA018038-100ul |
|
|
HPA018038-100ul |
Product Guarantee and Expert Support
