Anti-TWF1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TWF1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA018116
• Supplier Catalog Number: HPA018116
• Alternative Catalog Number: ATA-HPA018116-100,ATA-HPA018116-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: A6, PTK9

Product Description

twinfilin actin-binding protein 1

Additional Information

Anti-TWF1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 5756
• UniProt: Q12792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: AEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEIDIKNEIIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDY
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TWF1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Western blot analysis in human cell line A-431.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA018116

HPA018116

HPA018116