Anti-FXR1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FXR1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA018246
• Supplier Catalog Number: HPA018246
• Alternative Catalog Number: ATA-HPA018246-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FXR1

Product Description

fragile X mental retardation, autosomal homolog 1

Additional Information

Anti-FXR1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 8087
• UniProt: P51114
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FXR1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Western blot analysis in human cell line U-251 MG.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA018246

HPA018246

HPA018246