Anti-PAPPA2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PAPPA2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA018430
• Supplier Catalog Number: HPA018430
• Alternative Catalog Number: ATA-HPA018430-100,ATA-HPA018430-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: PAPP-A2, PAPPE, PLAC3

Product Description

pappalysin 2

Additional Information

Anti-PAPPA2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 60676
• UniProt: Q9BXP8
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GDSSEDGHYFRGHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVLQGFE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PAPPA2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemistry analysis in human placenta and prostate tissues using Anti-PAPPA2 antibody. Corresponding PAPPA2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human liver, lymph node, placenta and prostate using Anti-PAPPA2 antibody HPA018430 (A) shows similar protein distribution across tissues to independent antibody HPA018412 (B).

Immunohistochemical staining of human placenta shows high expression.

Immunohistochemical staining of human prostate shows low expression as expected.

Immunohistochemical staining of human liver using Anti-PAPPA2 antibody HPA018430.

Immunohistochemical staining of human lymph node using Anti-PAPPA2 antibody HPA018430.

HPA018430

HPA018430

HPA018430