Anti-PDCD5

Catalog Number: ATA-HPA018471
Article Name: Anti-PDCD5
Biozol Catalog Number: ATA-HPA018471
Supplier Catalog Number: HPA018471
Alternative Catalog Number: ATA-HPA018471-100,ATA-HPA018471-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC9294, TFAR19
programmed cell death 5
Anti-PDCD5
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9141
UniProt: O14737
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PDCD5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-PDCD5 antibody. Corresponding PDCD5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA018471-100ul
HPA018471-100ul
HPA018471-100ul