Anti-PDLIM7
Catalog Number:
ATA-HPA018794
- Images (7)
| Article Name: | Anti-PDLIM7 |
| Biozol Catalog Number: | ATA-HPA018794 |
| Supplier Catalog Number: | HPA018794 |
| Alternative Catalog Number: | ATA-HPA018794-100,ATA-HPA018794-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ENIGMA |
| PDZ and LIM domain 7 (enigma) |
| Anti-PDLIM7 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9260 |
| UniProt: | Q9NR12 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PDLIM7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to actin filaments & focal adhesion sites. |
|
|
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Western blot analysis in human cell lines U2OS and HEK293 using Anti-PDLIM7 antibody. Corresponding PDLIM7 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis using Anti-PDLIM7 antibody HPA018794 (A) shows similar pattern to independent antibody HPA048815 (B). |
|
|
HPA018794-100ul |
|
|
HPA018794-100ul |
|
|
HPA018794-100ul |
Product Guarantee and Expert Support
